1.67 Rating by ClearWebStats
azenx.com is 7 years 7 months 6 days old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, azenx.com is SAFE to browse.
Get Custom Widget

Traffic Report of Azenx

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for azenx.com Good
WOT Privacy: WOT privacy rank for azenx.com Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
70
Siteadvisor Rating
View azenx.com site advisor rating Not Applicable

Where is azenx.com server located?

Hosted IP Address:

92.48.78.51 View other site hosted with azenx.com

Hosted Country:

azenx.com hosted country GB azenx.com hosted country

Location Latitude:

51.5228

Location Longitude:

-0.71986

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View azenx.com HTML resources

Homepage Links Analysis

Azenx – Hi-Gear Inspiration

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 3
H3 Headings: 2 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 92.48.78.51)

Nothing found for 406 Shtml

azenx.com favicon - i-doo.org

View azenx.com Pagerank   azenx.com alexa rank 3,656,703   azenx.com website value $ 240.00

The Prestige

azenx.com favicon - dianafigueroapa.com

View azenx.com Pagerank   azenx.com alexa rank 922,219   azenx.com website value $ 720.00

A Glass of Blessings -

azenx.com favicon - helmetcamfirefighter.com

View azenx.com Pagerank   azenx.com alexa rank 418,357   azenx.com website value $ 5,760.00

Chalet of the Smokies | Vacation blog

azenx.com favicon - chaletsofthesmokies.com

View azenx.com Pagerank   azenx.com alexa rank Not Applicable   azenx.com website value $ 8.95

蛻台コ倶コ倶サカ縺ョ隗」豎コ繧貞シ∬ュキ螢ォ縺ォ萓晞

azenx.com favicon - newarkdelawarecriminaldefenselawyer.com

View azenx.com Pagerank   azenx.com alexa rank Not Applicable   azenx.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 406
Status: 406 Not Acceptable
Date: Wed, 19 Oct 2016 04:06:10 GMT
Server: Apache
X-Powered-By: PHP/5.4.30
Link: ; rel="https://api.w.org/", ; rel=shortlink
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for azenx.com

Domain Registrar: INTERNET DOMAIN SERVICE BS CORP azenx.com registrar info
Registration Date: 2016-10-11 7 years 7 months 6 days ago
Last Modified: 2016-10-12 7 years 7 months 5 days ago
Expiration Date: 2017-10-11 6 years 7 months 5 days ago

Domain Nameserver Information

Host IP Address Country
ns1.seafooddomains.com azenx.com name server information 213.229.101.106 azenx.com server is located in United Kingdom United Kingdom
ns2.seafooddomains.com azenx.com name server information 213.229.101.106 azenx.com server is located in United Kingdom United Kingdom

DNS Record Analysis

Host Type TTL Extra
azenx.com A 14400 IP:92.48.78.51
azenx.com NS 86400 Target:a.gtld-servers.net
azenx.com NS 86400 Target:c.gtld-servers.net
azenx.com NS 86400 Target:b.gtld-servers.net
azenx.com NS 86400 Target:d.gtld-servers.net
azenx.com SOA 86400 MNAME:a.gtld-servers.net
RNAME:postmaster.nocmonitoring.org
Serial:2016101400
Refresh:3600
Retry:7200
Expire:1209600
azenx.com MX 14400 Target:azenx.com
azenx.com TXT 14400 TXT:v=spf1 ip4:92.48.96.23 a mx
include:relay.mailchannels.net ?all

Similarly Ranked Websites to Azenx

Google

azenx.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View azenx.com Pagerank   Alexa rank for azenx.com 1   website value of azenx.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

azenx.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View azenx.com Pagerank   Alexa rank for azenx.com 1   website value of azenx.com $ 8,833,062,960.00

Gmail

azenx.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View azenx.com Pagerank   Alexa rank for azenx.com 1   website value of azenx.com $ 8,833,062,960.00

Android Apps on Google Play

azenx.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View azenx.com Pagerank   Alexa rank for azenx.com 1   website value of azenx.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

azenx.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View azenx.com Pagerank   Alexa rank for azenx.com 1   website value of azenx.com $ 8,833,062,960.00